missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRIM16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56990-25ul
This item is not returnable.
View return policy
Description
TRIM16 Polyclonal specifically detects TRIM16 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| TRIM16 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
| DKFZp434O1826, EBBPtripartite motif-containing 16, Estrogen-responsive B box protein, tripartite motif containing 16, tripartite motif-containing protein 16 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 10626 | |
| Human | |
| Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TRIM16 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YCKFKNTEDITFPSVYIGLKDKLSGIRKVITESTVHLIQLLENYKKKLQEFSKEEEYDIRTQVSAIVQRKYWTSKPEPST | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. | |
| IgG |
Correzione del contenuto del prodotto
Fornite il vostro feedback sul contenuto del prodotto compilando il modulo sottostante.
Titolo del prodotto
For Research Use Only
Individuate un'opportunità di miglioramento?Condividi una correzione di contenuto