TRIM26 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-47595-25ul

Se flere versioner af dette produkt

Artikelnummer. 18693986

€ 280.00 / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

Denne vare kan ikke returneres. Se returpolicy

Beskrivelse

TRIM26 Polyclonal specifically detects TRIM26 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Tekniske data

Antigen	TRIM26
Classification	Polyclonal
Dilution	Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Gene Alias	Acid finger protein, AFP, RNF95RING finger protein 95, tripartite motif containing 26, tripartite motif-containing protein 26, widely expressed acid zinc finger protein, Zinc finger protein 173, ZNF173tripartite motif-containing 26
Host Species	Rabbit
Purification Method	Affinity Purified
Regulatory Status	RUO
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols	TRIM26
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: FKKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLLCVM
Quantity	25 μL
Research Discipline	Zinc Finger
Gene ID (Entrez)	7726
Target Species	Human
Isotype	IgG

Produktforslag

Korrektion af produktindhold

Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.

Produkttitel

Dit navn

E-mailadresse *

Type af problem *

Detaljeret beskrivelse af problem/anmodning *

Ved at klikke på Send, anerkender du, at du kan blive kontaktet af Fisher Scientific med hensyn til den feedback, du har givet i denne formular. Vi deler ikke dine oplysninger til andre formål. Alle angivne kontaktoplysninger skal også vedligeholdes i overensstemmelse med vores Privatlivspolitik.

Ophæve Send

Mange tak! Din feedback er blevet sendt. Hos Fisher Scientific arbejder vi altid på at forbedre vores indhold for dig. Vi sætter pris på din feedback.

For Research Use Only

Ser du en mulighed for forbedring?Del en indholdskorrektion

TRIM26 Antibody, Novus Biologicals™

Beskrivelse

Tekniske data

Produktforslag

Dokumenter

Kampagner