missing translation for 'onlineSavingsMsg'
Learn More
Learn More
tropomyosin-2 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-95197-0.02ml
This item is not returnable.
View return policy
Description
tropomyosin-2 Polyclonal antibody specifically detects tropomyosin-2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)
Specifications
| tropomyosin-2 | |
| Polyclonal | |
| Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:50-1:100, Immunoprecipitation 1:500 - 1:1000, Immunohistochemistry-Paraffin | |
| distal, type 1, tropomyosin 2 (beta) | |
| A synthetic peptide corresponding to a sequence within amino acids 1-100 of human tropomyosin-2 (NP_003280.2). MDAIKKKMQMLKLDKENAIDRAEQAEADKKQAEDRCKQLEEEQQALQKKLKGTEDEVEKYSESVKEAQEKLEQAEKKATDAEADVASLNRRIQLVEEELD | |
| 0.02 mL | |
| Cell Biology, Cytoskeleton Markers, Signal Transduction | |
| 7169 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction