missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Troponin C (cardiac) Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 792.00
Specifications
| Antigen | Troponin C (cardiac) |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18246362
|
Novus Biologicals
NBP2-55151 |
100 μL |
€ 792.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18647868
|
Novus Biologicals
NBP2-55151-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
Troponin C (cardiac) Polyclonal specifically detects Troponin C (cardiac) in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| Troponin C (cardiac) | |
| Polyclonal | |
| Rabbit | |
| Cellular Markers, Cytoskeleton Markers | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| 7134 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MDDIYKAAVEQLTEEQKNEFKAAFDIFVLGAEDGCISTKELGKVM | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| cardiac troponin C, CMD1Z, CMH13, slow twitch skeletal/cardiac muscle troponin C, TNC, TN-C, TNNC, troponin C type 1 (slow), troponin C, slow, troponin C, slow skeletal and cardiac muscles, troponin C1, slow | |
| TNNC1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title