missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
TRPC5 Polyclonal antibody specifically detects TRPC5 in Human samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
Specifications
| Antigen | TRPC5 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:1000, Immunocytochemistry/ Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | hTRP5, hTRP-5, short transient receptor potential channel 5, transient receptor potential cation channel, subfamily C, member 5, Transient receptor protein 5, TRP-5, TRP5transient receptor potential channel 5, TrpC5 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 800-900 of human TRPC5 (NP_036603.1). NLGCKKKTCHGPPLIRTMPRSSGAQGKSKAESSSKRSFMGPSLKKLGLLFSKFNGHMSEPSSEPMYTISDGIVQQHCMWQDIRYSQMEKGKAEACSQSEIN |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?