missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TRPM3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 305.00 - € 668.85
Specifications
| Antigen | TRPM3 |
|---|---|
| Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18692614
|
Novus Biologicals
NBP3-21371-100ul |
100 μg |
€ 708.00 € 668.85 / 100µL Save € 39.15 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18616244
|
Novus Biologicals
NBP3-21371-25ul |
25 μg |
€ 305.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
TRPM3 Polyclonal antibody specifically detects TRPM3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| TRPM3 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Signal Transduction | |
| PBS, pH 7.2, 40% glycerol | |
| 80036 | |
| IgG | |
| Affinity purified |
| Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| EC 2.3.1.31, EC 5.99.1.3, Long transient receptor potential channel 3, LTrpC3, LTrpC-3, LTRPC3KIAA1616MLSN2GON-2, melastatin 2, melastatin-2, transient receptor potential cation channel subfamily M member 3, transient receptor potential cation channel, subfamily M, member 3 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VDIRLAQLEDLIGRMATALERLTGLERAESNKIRSRTSSDCTDAAYIVRQSSFNSQEGNTFKLQ | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title