missing translation for 'onlineSavingsMsg'
Learn More
Learn More
TSPEAR Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-55659
This item is not returnable.
View return policy
Description
TSPEAR Polyclonal specifically detects TSPEAR in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| TSPEAR | |
| Polyclonal | |
| Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| C21orf29, Chromosome 21 Open Reading Frame 29, Deafness, Autosomal Recessive 98, DFNB98, Thrombospondin Type Laminin G Domain And EAR Repeats, Thrombospondin-Type Laminin G Domain And EAR Repeat-Containing Protein, Thrombospondin-Type Laminin G Domain And EAR Repeats-Containing Protein, TSP-EAR | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 54084 | |
| Human | |
| IgG |
| Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| TSPEAR | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KGQEFSVIYKWSHRKLKFTPYQSIATHSARDWEAFEVDGEHFLAVANHREGDNHNIDSVIYKWNPATRLFEANQTIATSGAYDWEFFSVGPYSFLVVANTFNGTST | |
| 100 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction