missing translation for 'onlineSavingsMsg'
Learn More

Tubby Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Brand: Novus Biologicals NBP2-48924-25ul

View more versions of this product

Product Code. 18619115

€ 280.00 / 25µL

Please sign in to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Tubby Polyclonal antibody specifically detects Tubby in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen	Tubby
Classification	Polyclonal
Dilution	Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias	rd5, tubby (mouse) homolog, tubby homolog (mouse), tubby homologue, tubby protein homolog
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: LPSFWVSFFAETGILFPGGTPWPMGSQHSKQHRKPGPLKRGHRRDRRTTRRKYWKEGREI
Quantity	25 μL
Research Discipline	Cell Biology, Cell Cycle and Replication, Cellular Markers, Chromatin Research, Neuroscience, Transcription Factors and Regulators
Gene ID (Entrez)	7275
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype	IgG

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), 40% Glycerol
Host Species	Rabbit
Purification Method	Immunogen affinity purified
Regulatory Status	RUO
Primary or Secondary	Primary
Target Species	Human
Form	Purified

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Description détaillée du problème/de la demande *

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.

Annuler Soumettre

Merci de nous aider à améliorer notre site web. Votre commentaire a été soumis

Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu

Tubby Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions