missing translation for 'onlineSavingsMsg'
Learn More

UAP56 Antibody [Alexa Fluor« 700], Novus Biologicals Biologicals™

Product Code. 30515593 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.1mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30515593 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30515593 Supplier Novus Biologicals Supplier No. NBP338530AF700

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

UAP56 Polyclonal antibody specifically detects UAP56 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Western Blot,Immunohistochemistry (Paraffin),Immunocytochemistry/ Immunofluorescence
TRUSTED_SUSTAINABILITY

Specifications

Antigen UAP56
Applications ELISA, Immunohistochemistry, Western Blot, Immunohistochemistry (Paraffin), Immunocytochemistry/Immunofluorescence
Classification Polyclonal
Conjugate Alexa Fluor 700
Formulation 50mM Sodium Borate
Gene Alias 56 kDa U2AF65-associated protein, ATP-dependent RNA helicase p47, DEAD (Asp-Glu-Ala-Asp) box polypeptide 39B, DEAD box protein UAP56, EC 3.6.4.13, HLA-B associated transcript 1, HLA-B-associated transcript 1 protein, spliceosome RNA helicase BAT1, UAP56D6S81EBAT1nuclear RNA helicase (DEAD family)
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 319-428 of human UAP56 (NP_004631.1).,, Sequence:, RGMPQEERLSRYQQFKDFQRRILVATNLFGRGMDIERVNIAFNYDMPEDSDTYLHRVARAGRFGTKGLAITFVSDENDAKILNDVQDRFEVNISELPDEIDISSYIEQTR
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Proteases & Other Enzymes
Primary or Secondary Primary
Gene ID (Entrez) 7919
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.