missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UbcH5a/UBE2D1 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
€ 213.00 - € 507.00
Specifications
| Antigen | UbcH5a/UBE2D1 |
|---|---|
| Dilution | ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Monoclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30232220
|
Novus Biologicals
NBP3-33268-100ul |
100 μL |
€ 507.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30232636
|
Novus Biologicals
NBP3-33268-20ul |
20 μL |
€ 213.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UbcH5a/UBE2D1 Monoclonal antibody specifically detects UbcH5a/UBE2D1 in Human,Mouse,Rat samples. It is validated for ELISA,Immunohistochemistry,Immunohistochemistry (Paraffin)Specifications
| UbcH5a/UBE2D1 | |
| ELISA, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Hypoxia | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| 7321 | |
| IgG | |
| Affinity purified |
| ELISA Recommended starting concentration is 1 μg/mL, Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Monoclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| E2(17)KB1, Stimulator of Fe transportUBC4/5 homolog, UBC4/5, UBC5A, UbcH5, UbcH5A, UBCH5AEC 6.3.2.19, UBCH5SFT, Ubiquitin carrier protein D1, ubiquitin-conjugating enzyme E2 D1, Ubiquitin-conjugating enzyme E2(17)KB 1, Ubiquitin-conjugating enzyme E2-17 kDa 1, ubiquitin-conjugating enzyme E2D 1 (UBC4/5 homolog, yeast), Ubiquitin-protein ligase D1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 50-147 of human UbcH5a/UBE2D1 (NP_003329.1).,, Sequence:, FFLTVHFPTDYPFKPPKIAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPDIAQIYKSDKEKYNRHAREWTQKYAM | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title