missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UBXN6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-80648-25ul
This item is not returnable.
View return policy
Description
UBXN6 Polyclonal specifically detects UBXN6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| UBXN6 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| DKFZp667D109, FLJ00394, UBX domain containing 1, UBX domain protein 6, UBX domain-containing 1, UBX domain-containing 2, UBX domain-containing protein 1, UBX domain-containing protein 6, UBXD1, UBXDC2 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 80700 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| UBXN6 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:QDTIRNQVRKELQAEATVSGSPEAPGTNVVSEPREEGSAHLAVPGVYFTCPLTGATLRKDQRDACIKEAILLHFSTDPV | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?
For Research Use Only