missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UCK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 288.00 - € 589.00
Specifications
| Antigen | UCK |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18120528
|
Novus Biologicals
NBP2-47587 |
0.1 mL |
€ 589.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18610716
|
Novus Biologicals
NBP2-47587-25ul |
25 μL |
€ 288.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UCK Polyclonal specifically detects UCK in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
| UCK | |
| Polyclonal | |
| Rabbit | |
| DNA replication Transcription Translation and Splicing | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 83549 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IQDILNGDICKWHRGGSNGRSYKRTFSEPGDHPGMLTSGKRSHLESSSRP | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| Cytidine monophosphokinase 1, EC 2.7.1.48, FLJ12255, Uridine monophosphokinase 1, uridine-cytidine kinase 1, URK1UCK 1 | |
| UCK1 | |
| IgG | |
| Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title