missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UCN2 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 188.00 - € 470.00
Specifications
| Antigen | UCN2 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18618402
|
Novus Biologicals
NBP2-94031-0.02ml |
0.02 mL |
€ 188.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18602072
|
Novus Biologicals
NBP2-94031-0.1ml |
0.1 mL |
€ 470.00
0.01mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UCN2 Polyclonal antibody specifically detects UCN2 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| UCN2 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| SRPUrocortin II, Stresscopin-related peptide, Ucn II, UCNI, UCN-II, UR, urocortin 2, urocortin-2, URPUrocortin-related peptide | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 20-112 of human UCN2 (NP_149976.1). VPVTPIPTFQLRPQNSPQTTPRPAASESPSAAPTWPWAAQSHCSPTRHPGSRIVLSLDVPIGLLQILLEQARARAAREQATTNARILARVGHC | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 90226 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title