missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UFD1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP3-21251-25ul
This item is not returnable.
View return policy
Description
UFD1L Polyclonal antibody specifically detects UFD1L in Human samples. It is validated for Immunofluorescence
Specifications
| UFD1L | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
| ATP1C, ATP1G1ATPase, Na+/K+ transporting, gamma 1 polypeptide, FXYD domain containing ion transport regulator 2, FXYD domain-containing ion transport regulator 2, HOMG2, hypomagnesemia 2, renal, MGC12372, Na(+)/K(+) ATPase subunit gamma, Sodium pump gamma chain, sodium/potassium-transporting ATPase subunit gamma, Sodium-potassium-ATPase, gamma polypeptide | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSR | |
| 25 μg | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, 40% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 7353 | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction