missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UGT1A6 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-49113-25ul
This item is not returnable.
View return policy
Description
UGT1A6 Polyclonal antibody specifically detects UGT1A6 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| UGT1A6 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| GNT1UDPGT 1-6, HLUGP, HLUGP1, MGC29860, Phenol-metabolizing UDP-glucuronosyltransferase, UDP glucuronosyltransferase 1 family, polypeptide A6, UDP glycosyltransferase 1 family, polypeptide A6, UDP-glucuronosyltransferase 1 family polypeptide A6s, UDP-glucuronosyltransferase 1-6, UDP-glucuronosyltransferase 1A6, UDP-glucuronosyltransferase 1-F, UDPGT, UGT1, UGT1*6, UGT1.6, UGT1-06, UGT1A6S, UGT-1F, UGT1FEC 2.4.1.17 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: WLSMKDIVEVLSDRGHEIVVVVPEVNLLLKESKYYTRKIYPVPYDQEELKNRYQSFGNNHFAERSFLTAPQTEYRNNMIVIGLY | |
| 25 μL | |
| Cancer | |
| 54578 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction