missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UHRF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 369.00 - € 593.00
Specifications
| Antigen | UHRF1 |
|---|---|
| Dilution | Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18688008
|
Novus Biologicals
NBP2-68720-25ul |
25 μL |
€ 369.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18601777
|
Novus Biologicals
NBP2-68720 |
100 μg |
€ 593.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UHRF1 Polyclonal antibody specifically detects UHRF1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| UHRF1 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA Repair, Zinc Finger | |
| PBS (pH 7.2) and 40% Glycerol | |
| 29128 | |
| IgG | |
| Protein A purified |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| E3 ubiquitin-protein ligase UHRF1, EC 6.3.2, EC 6.3.2.-, FLJ21925, hNP95, huNp95, ICBP90NP95, Inverted CCAAT box-binding protein of 90 kDa, Np95, Nuclear protein 95, Nuclear zinc finger protein Np95, RING finger protein 106, RNF106MGC138707, Transcription factor ICBP90, Ubiquitin-like PHD and RING finger domain-containing protein 1, ubiquitin-like with PHD and ring finger domains 1, ubiquitin-like, containing PHD and RING finger domains, 1, Ubiquitin-like-containing PHD and RING finger domains protein 1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RARTIIKWQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDCRIIFVDE | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title