missing translation for 'onlineSavingsMsg'
Learn More
Learn More
UQCRFS1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 280.00 - € 624.00
Specifications
| Antigen | UQCRFS1 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18108307
|
Novus Biologicals
NBP2-38623 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18697185
|
Novus Biologicals
NBP2-38623-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
UQCRFS1 Polyclonal specifically detects UQCRFS1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
| UQCRFS1 | |
| Polyclonal | |
| Rabbit | |
| Breast Cancer | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Complex III subunit 5, Cytochrome b-c1 complex subunit 5, cytochrome b-c1 complex subunit Rieske, mitochondrial, EC 1.10.2.2, Rieske iron-sulfur protein, RIP1, RIS1, RISPUbiquinol-cytochrome c reductase iron-sulfur subunit, ubiquinol-cytochrome c reductase, Rieske iron-sulfur polypeptide 1, UQCR5 | |
| UQCRFS1 | |
| IgG | |
| Affinity Purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P47985 | |
| 7386 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: VTQFVSSMSASADVLALAKIEIKLSDIPEGKNMAFKWRGKPLFVRHRTQKEIEQEAAVELSQLRDPQHDL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title