missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Uroplakin II Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 353.00 - € 572.00
Specifications
| Antigen | Uroplakin II |
|---|---|
| Dilution | Western Blot 0.04-0.4 μg/mL, Flow Cytometry 1:10-1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
| Applications | Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18626995
|
Novus Biologicals
NBP2-38904-25ul |
25 μL |
€ 353.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18748393
|
Novus Biologicals
NBP2-38904 |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Beschreibung
Uroplakin II Polyclonal specifically detects Uroplakin II in Human samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| Uroplakin II | |
| Western Blot, Flow Cytometry, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| UP2, UPII, UPK2 uroplakin 2 | |
| UPK2 | |
| IgG | |
| Affinity Purified |
| Western Blot 0.04-0.4 μg/mL, Flow Cytometry 1:10-1:1000, Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| O00526 | |
| 7379 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SVVDSGAGFTVTRLSAYQVTNLVPGTKFYISYLVKKGTATESSREIPMSTLPRRNMESIGLG | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title