missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. USAG1/SOSTDC1 Antibody, Novus Biologicals™

USAG1/SOSTDC1 Antibody, Novus Biologicals™

Product Code. 18063417 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18063417 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 18063417 Supplier Novus Biologicals Supplier No. NBP198525

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

USAG1/SOSTDC1 Polyclonal specifically detects USAG1/SOSTDC1 in Human samples. It is validated for Western Blot.
TRUSTED_SUSTAINABILITY

Specifications

Antigen USAG1/SOSTDC1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_056279
Gene Alias cystine-knot containing secreted protein, DKFZp564D206, Ectodermal BMP inhibitor, ECTODIN, sclerostin domain containing 1, sclerostin domain-containing protein 1, USAG-1, USAG1uterine sensitization-associated protein-1, Uterine sensitization-associated gene 1 protein
Gene Symbols SOSTDC1
Host Species Rabbit
Immunogen The immunogen for this antibody is SOSTDC1 - C-terminal region. Peptide sequence ITVVTACKCKRYTRQHNESSHNFESMSPAKPVQHHRERKRASKSSKHSMS.
Molecular Weight of Antigen 21 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 25928
Test Specificity Bovine: 79%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Sélectionnez un problème

En cliquant sur Soumettre, vous reconnaissez que vous pouvez être contacté par Fisher Scientific au sujet des informations que vous avez fournies dans ce formulaire. Nous ne partagerons pas vos informations à d'autres fins. Toutes les informations de contact fournies seront également conservées conformément à notre politique de confidentialité. Politique de confidentialité.