missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Description
USP12 Polyclonal antibody specifically detects USP12 in Human, Mouse, Rat samples. It is validated for Western Blot
Specifications
Specifications
| Antigen | USP12 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500-1:1000 |
| Formulation | PBS (pH 7.3), 50% glycerol |
| Gene Alias | Deubiquitinating enzyme 12, EC 3.1.2.15, EC 3.4.19.12, UBH1ubiquitin specific protease 12, ubiquitin carboxyl-terminal hydrolase 12, ubiquitin specific peptidase 12, ubiquitin specific protease 12 like 1, ubiquitin thioesterase 12, Ubiquitin thiolesterase 12, Ubiquitin-hydrolyzing enzyme 1, Ubiquitin-specific-processing protease 12, USP12L1 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human USP12 (NP_872294.2). MEILMTVSKFASICTMGANASALEKEIGPEQFPVNEHYFGLVNFGNTCYCNSVLQALYFCRPFREKVLAYKSQPRKKESLLTCLADLFHSIATQKKKVGV |
| Purification Method | Affinity purified |
| Show More |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?