missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP13 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | USP13 |
|---|---|
| Dilution | Western Blot 1:1000 - 1:2000, ELISA |
| Applications | ELISA, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30230074
|
Novus Biologicals
NBP3-35117-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30231129
|
Novus Biologicals
NBP3-35117-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
USP13 Polyclonal antibody specifically detects USP13 in Mouse,Rat samples. It is validated for ELISA,Western BlotSpecifications
| USP13 | |
| ELISA, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Mouse, Rat | |
| Deubiquitinating enzyme 13, EC 3.1.2.15, EC 3.4.19.12, Isopeptidase T-3, ISOT-3, ISOT3IsoT-3, ubiquitin carboxyl-terminal hydrolase 13, ubiquitin specific peptidase 13 (isopeptidase T-3), ubiquitin specific protease 13 (isopeptidase T-3), ubiquitin thioesterase 13, Ubiquitin thiolesterase 13, Ubiquitin-specific-processing protease 13 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 90-200 of human USP13 (NP_003931.2).,, Sequence:, MHLKRHVREKVRGASGGALPKRRNSKIFLDLDTDDDLNSDDYEYEDEAKLVIFPDHYEIALPNIEELPALVTIACDAVLSSKSPYRKQDPDTWENELPVSKYANNLTQLDN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:1000 - 1:2000, ELISA | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 8975 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title