missing translation for 'onlineSavingsMsg'
Learn More
Learn More
USP45 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP1-81200-25ul
This item is not returnable.
View return policy
Description
USP45 Polyclonal specifically detects USP45 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| USP45 | |
| Polyclonal | |
| Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Deubiquitinating enzyme 45, EC 3.1.2.15, EC 3.4.19.12, MGC14793, ubiquitin carboxyl-terminal hydrolase 45, ubiquitin specific peptidase 45, ubiquitin specific protease 45, ubiquitin thioesterase 45, Ubiquitin thiolesterase 45, Ubiquitin-specific-processing protease 45 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 85015 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| USP45 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:EKAKRSKRPTVPHDEDSSDDIAVGLTCQHVSHAISVNHVKRAIAENLWSVCSECLEERRFYDGQLVLTSDIWLCLKCGFQ | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction