missing translation for 'onlineSavingsMsg'
Learn More
Learn More
SERP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 483.00
Specifications
| Antigen | SERP1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
SERP1 Polyclonal specifically detects SERP1 in Human, Mouse samples. It is validated for Western Blot.Specifications
| SERP1 | |
| Polyclonal | |
| Rabbit | |
| NP_055260 | |
| 27230 | |
| The immunogen for this antibody is SERP1 - N-terminal region. Peptide sequence IRMANEKHSKNITQRGNVAKTSRNAPEEKASVGPWLLALFIFVVCGSAIF. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| FLJ43424, MGC117327, MGC133321, RAMP4MGC133322, ribosome associated membrane protein 4, Ribosome-attached membrane protein 4, stress-associated endoplasmic reticulum protein 1 | |
| SERP1 | |
| IgG | |
| 7 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title