missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VCAM-1/CD106 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Marque: Novus Biologicals NBP2-38223-25ul
Les retours ne sont pas autorisés pour ce produit.
Afficher la politique du retour.
Description
VCAM-1/CD106 Polyclonal specifically detects VCAM-1/CD106 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Spécification
| VCAM-1/CD106 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| P19320 | |
| VCAM1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: IGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSG | |
| 25 μL | |
| Cancer, Mesenchymal Stem Cell Markers, Stem Cell Markers | |
| 7412 | |
| Human | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| CD106, CD106 antigen, DKFZp779G2333, INCAM-100, L1CAM, MGC99561, vascular cell adhesion molecule 1, vascular cell adhesion protein 1, V-CAM 1, VCAM1, VCAM-1 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Correction du contenu d'un produit
Veuillez fournir vos retours sur le contenu du produit en remplissant le formulaire ci-dessous.
Nom du produit
Vous avez repéré une opportunité d'amélioration ?Partager une correction de contenu