missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VE-Statin/EGFL7 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68693-25ul
This item is not returnable.
View return policy
Description
VE-Statin/EGFL7 Polyclonal antibody specifically detects VE-Statin/EGFL7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| VE-Statin/EGFL7 | |
| Polyclonal | |
| Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
| EGF-like protein 7, EGF-like-domain, multiple 7, epidermal growth factor-like protein 7, MEGF7, MGC111117, Multiple EGF-like domains protein 7, Multiple epidermal growth factor-like domains protein 7, NEU1 protein, NOTCH4-like protein, RP11-251M1.2, Vascular endothelial statin, VE-STATIN, Zneu1 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: RGDTCQSGVDSAMKEEVQRLQSRVDLLEEKLQLVLAPLHSLASQALEHGLPDPGSLLVHSFQQLGRIDSLSEQISFLEEQLGSCSCKKD | |
| 25 μL | |
| Angiogenesis | |
| 51162 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction