missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VEGFR3/Flt-4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68863
This item is not returnable.
View return policy
Description
VEGFR3/Flt-4 Polyclonal antibody specifically detects VEGFR3/Flt-4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| VEGFR3/Flt-4 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| EC 2.7.10, EC 2.7.10.1, FLT-4, fms-related tyrosine kinase 4, LMPH1A, PCLFLT41, soluble VEGFR3 variant 1, soluble VEGFR3 variant 2, soluble VEGFR3 variant 3, Tyrosine-protein kinase receptor FLT4, vascular endothelial growth factor receptor 3, VEGFR-3, VEGFR3Fms-like tyrosine kinase 4 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: LQEEEEVCMAPRSSQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYK | |
| 100 μg | |
| Angiogenesis, Cancer, Hypoxia, Protein Kinase | |
| 2324 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction