missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. VEGFR3/Flt-4 Antibody, Novus Biologicals™

VEGFR3/Flt-4 Antibody, Novus Biologicals™

Product Code. p-200059420 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
100 μg
25 μL
Unit Size:
100µL
25µL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18621938 25 μL 25µL
18673607 100 μg 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18621938 Supplier Novus Biologicals Supplier No. NBP26886325ul

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

VEGFR3/Flt-4 Polyclonal antibody specifically detects VEGFR3/Flt-4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
TRUSTED_SUSTAINABILITY

Specifications

Antigen VEGFR3/Flt-4
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias EC 2.7.10, EC 2.7.10.1, FLT-4, fms-related tyrosine kinase 4, LMPH1A, PCLFLT41, soluble VEGFR3 variant 1, soluble VEGFR3 variant 2, soluble VEGFR3 variant 3, Tyrosine-protein kinase receptor FLT4, vascular endothelial growth factor receptor 3, VEGFR-3, VEGFR3Fms-like tyrosine kinase 4
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LQEEEEVCMAPRSSQSSEEGSFSQVSTMALHIAQADAEDSPPSLQRHSLAARYYNWVSFPGCLARGAETRGSSRMKTFEEFPMTPTTYK
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Angiogenesis, Cancer, Hypoxia, Protein Kinase
Primary or Secondary Primary
Gene ID (Entrez) 2324
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.