missing translation for 'onlineSavingsMsg'
Learn More
Learn More
GSTA4 Antibody, Novus Biologicals™
Rabbit Monoclonal Antibody
Brand: Novus Biologicals NBP3-33437-20ul
This item is not returnable.
View return policy
Description
GSTA4 Monoclonal antibody specifically detects GSTA4 in Human samples. It is validated for ELISA,Western Blot
Specifications
| GSTA4 | |
| Monoclonal | |
| Western Blot 1:500 - 1:1000, ELISA Recommended starting concentration is 1 μg/mL | |
| DKFZp686D21185, EC 2.5.1.18, glutathione S-alkyltransferase A4, glutathione S-aralkyltransferase A4, glutathione S-aryltransferase A4, glutathione S-transferase A4, Glutathione S-transferase A4-4, glutathione S-transferase alpha 4, glutathione transferase A4-4, GST class-alpha member 4, GSTA4-4, GTA4, S-(hydroxyalkyl)glutathione lyase A4 | |
| Recombinant funsion protein containing a sequence corresponding to amino acids 1-100 of human GSTA4 (NP_001503.1).,, Sequence:, MAARPKLHYPNGRGRMESVRWVLAAAGVEFDEEFLETKEQLYKLQDGNHLLFQQVPMVEIDGMKLVQTRSILHYIADKHNLFGKNLKERTLIDMYVEGTL | |
| 20 μL | |
| metabolism | |
| 2941 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
| ELISA, Western Blot | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol, 0.05% BSA | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Title
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
Spot an opportunity for improvement?