missing translation for 'onlineSavingsMsg'
Learn More
Learn More
VIPR2/VPAC2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 415.00 - € 624.00
Specifications
| Antigen | VIPR2/VPAC2 |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18463542
|
Novus Biologicals
NBP2-34149-25ul |
25 μL |
€ 415.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18194035
|
Novus Biologicals
NBP2-34149 |
0.1 mL |
€ 624.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
VIPR2/VPAC2 Polyclonal specifically detects VIPR2/VPAC2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| VIPR2/VPAC2 | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| Human | |
| P41587 | |
| 7434 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: NSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNITCWR | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Cancer, GPCR, Neuroscience, Neurotransmission, Signal Transduction | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| FLJ16511, Helodermin-preferring VIP receptor, PACAP type III receptor, PACAP-R3, PACAP-R-3, Pituitary adenylate cyclase-activating polypeptide type III receptor, vasoactive intestinal peptide receptor 2, vasoactive intestinal polypeptide receptor 2, VIP2R, VIP-R-2, VPAC2, VPCAP2R | |
| VIPR2 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title