missing translation for 'onlineSavingsMsg'
Learn More
Learn More
WISP3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-56060-25ul
This item is not returnable.
View return policy
Description
WISP3 Polyclonal specifically detects WISP3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications
| WISP3 | |
| Polyclonal | |
| Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL | |
| CCN family member 6, CCN6MGC125988, LIBC, MGC125987, MGC125989, PPAC, PPD, WISP-3, WNT1 inducible signaling pathway protein 3, WNT1-inducible-signaling pathway protein 3 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 8838 | |
| Human | |
| IgG |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
| CCN6 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWIT | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Korrektion af produktindhold
Dit input er vigtigt for os. Udfyld denne formular for at give feedback relateret til indholdet på dette produkt.
Produkttitel
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion