missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XCL1/Lymphotactin Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-46844
This item is not returnable.
View return policy
Description
XCL1/Lymphotactin Polyclonal antibody specifically detects XCL1/Lymphotactin in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| XCL1/Lymphotactin | |
| Polyclonal | |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Q9UBD3 | |
| Rabbit | |
| Immunogen affinity purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2), 40% Glycerol | |
| ATACSmall-inducible cytokine C1, C motif chemokine 1, chemokine (C motif) ligand 1, Cytokine SCM-1, LPTNSCM-1-alpha, LTNXC chemokine ligand 1, lymphotactin, lymphotaxin, SCM-1, SCM-1a, SCM1A, SCYC1SCM1, single cysteine motif 1a, small inducible cytokine subfamily C, member 1 (lymphotactin) | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: VCADPQATWVRDVVRSMDRKSNTRNNMIQTKPTGTQQSTNTAVTLTG | |
| 0.1 mL | |
| Immunology, Innate Immunity | |
| 6375 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction