missing translation for 'onlineSavingsMsg'
Learn More
Learn More
XPF Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 550.00
Specifications
| Antigen | XPF |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells |
| Applications | ELISA, Immunoprecipitation, Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
30227424
|
Novus Biologicals
NBP3-38510-100ul |
100 μL |
€ 550.00
100µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
30227299
|
Novus Biologicals
NBP3-38510-20ul |
20 μL |
€ 190.00
20µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
XPF Polyclonal antibody specifically detects XPF in Human,Mouse,Rat samples. It is validated for ELISA,Immunoprecipitation,Western BlotSpecifications
| XPF | |
| ELISA, Immunoprecipitation, Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, DNA Repair, Nucleotide Excision Repair | |
| PBS (pH 7.3), 50% glycerol | |
| 2072 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500 - 1:2000, ELISA, Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| DNA excision repair protein ERCC-4, DNA repair protein complementing XP-F cells, EC 3.1, ERCC11, excision repair cross-complementing rodent repair deficiency, complementationgroup 4, xeroderma pigmentosum, complementation group F, XPFcomplementing defective, in Chinese hamster | |
| A synthetic peptide corresponding to a sequence within amino acids 513-782 of human XPF (NP_005227.1).,, Sequence:, GKPLRVYFLIYGGSTEEQRYLTALRKEKEAFEKLIREKASMVVPEEREGRDETNLDLVRGTASADVSTDTRKAGGQEQNGTQQSIVVDMREFRSELPSLIH | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title