missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Biochemical Reagents
  4. Peptides
  5. 18226465

Novus Biologicals™ YIPF5 Recombinant Protein Antigen

Product Code. 18226465 Shop All Bio Techne Products
missing translation for 'orderingAttributeHoverText'
Quantity:
100 μL
missing translation for 'unitSize'
100µL
Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Artikelnummer. 18226465

missing translation for 'mfr': Novus Biologicals™ NBP259007PEP

Please to purchase this item. Need a web account? Register with us today!

Dieser Artikel kann nicht zurückgegeben werden. Rückgaberichtlinie anzeigen

Beschreibung

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human YIPF5. Source: E.coli Amino Acid Sequence: NLNTDFYQTSYSIDDQSQQSYDYGGSGGPYSKQYAGYDYSQQGRFVPPDMMQPQQPYTGQIYQPTQAYTPASPQPFYGNNFEDEPPLLE The YIPF5 Recombinant Protein Antigen is derived from E. coli. The YIPF5 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
TRUSTED_SUSTAINABILITY

Spezifikation

Gene ID (Entrez) 81555
Purification Method >80% by SDS-PAGE and Coomassie blue staining
Common Name YIPF5 Recombinant Protein Antigen
Content And Storage Store at −20°C. Avoid freeze-thaw cycles.
Formulation PBS and 1M Urea, pH 7.4.
For Use With (Application) Blocking/Neutralizing, Control
Gene Alias FinGER5, Golgi Membrane Protein SB140, Protein YIPF5, SB140, SMAP5, SMAP-5, Smooth Muscle Cell Associated Protein 5, Smooth Muscle Cell-Associated Protein 5, Yip1 Domain Family Member 5, Yip1 Domain Family, Member 5, YIP1 Family Member 5, YIP1A, YPT-Inter
Gene Symbol YIPF5
Label Type Unlabeled
Product Type Recombinant Protein Antigen
Quantity 100 μL
Regulatory Status RUO
Source E.coli
Specific Reactivity This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51403. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Mehr anzeigen Weniger anzeigen

For Research Use Only.

Berichtigung von Produktinhalten

Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.

Name des Produkts

Indem Sie auf Absenden klicken, erklären Sie sich damit einverstanden, dass Fisher Scientific sich mit Ihnen in Verbindung setzen kann, um Ihr Feedback in diesem Formular zu bearbeiten. Wir werden Ihre Informationen nicht für andere Zwecke weitergeben. Alle bereitgestellten Kontaktinformationen werden in Übereinstimmung mit unserer Datenschutzrichtlinie aufbewahrt. Datenschutzrichtlinie.

Vielen Dank, dass Sie uns helfen, unsere Website zu verbessern. Ihr Feedback wurde übermittelt