missing translation for 'onlineSavingsMsg'
Learn More
Learn More
YTHDC1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-93050-0.1ml
This item is not returnable.
View return policy
Description
YTHDC1 Polyclonal antibody specifically detects YTHDC1 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunocytochemistry/ Immunofluorescence
Specifications
| YTHDC1 | |
| Polyclonal | |
| Western Blot 1:1000 - 1:5000, Immunocytochemistry/ Immunofluorescence 1:50-1:100 | |
| KIAA1966splicing factor YT521-B, Putative splicing factor YT521, YT521-B, YT521YTH domain-containing protein 1, YTH domain containing 1 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-74 of human YTHDC1 (NP_001026902.1). MAADSREEKDGELNVLDDILTEVPEQDDELYNPESEQDKNEKKGSKRKSDRMESTDTKRQKPSVHSRQLVSKPL | |
| 0.1 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 91746 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction