missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZA20D3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
€ 280.00 - € 523.95
Specifications
| Antigen | ZA20D3 |
|---|---|
| Dilution | Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18465831
|
Novus Biologicals
NBP1-90060-25ul |
25 μL |
€ 280.00
25µL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18719983
|
Novus Biologicals
NBP1-90060 |
 € 554.00 € 523.95 / 0.10mL Save € 30.05 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | ||||||
Beschreibung
ZA20D3 Polyclonal specifically detects ZA20D3 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Spezifikation
| ZA20D3 | |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 54469 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:SSNGRISPPATSVSSLSESLPVQCTDGSVPEAQSALDSTSSSMQPSPVSNQSLLSESVASSQLDSTSVDK | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Associated with PRK1 protein, AWP1Zinc finger A20 domain-containing protein 3, protein associated with PRK1, ZA20D3AN1-type zinc finger protein 6, ZFAND5B, zinc finger, A20 domain containing 3, zinc finger, AN1-type domain 6 | |
| ZFAND6 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Haben Sie Verbesserungsvorschläge?Übermitteln Sie eine inhaltliche Korrektur
Berichtigung von Produktinhalten
Bitte geben Sie uns Ihr Feedback zu den Produktinhalten, indem Sie das folgende Formular ausfüllen.
Name des Produkts