missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZADH2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 590.10
Specifications
| Antigen | ZADH2 |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18253994
|
Novus Biologicals
NBP2-58448 |
100 μL |
 € 624.00 € 590.10 / 100µL Save € 33.90 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18693578
|
Novus Biologicals
NBP2-58448-25ul |
25 μL |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZADH2 Polyclonal specifically detects ZADH2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Especificaciones
| ZADH2 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 284273 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKPEYLTLLVSGTTAYISLKELGGLSEGKKVLVTAAAGGTGQFAMQLSKKAKCHVIGTCSSDEKSAFLKSLGCDRPINYKTEPVGTVLKQEYPEGVDVVYESV | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| MGC45594, zinc binding alcohol dehydrogenase domain containing 2, zinc-binding alcohol dehydrogenase domain-containing protein 2 | |
| ZADH2 | |
| IgG | |
| Affinity Purified |
For Research Use Only
¿Detecta una oportunidad de mejora?Comparta una corrección de contenido
Corrección del contenido de un producto
Proporcione sus comentarios sobre el contenido del producto rellenando el siguiente formulario.
Título del producto