missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZBTB8A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 391.65 - € 540.75
Specifications
| Antigen | ZBTB8A |
|---|---|
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18629098
|
Novus Biologicals
NBP2-48618-25ul |
25 μL |
€ 415.00 € 391.65 / 25µL Save € 23.35 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18669428
|
Novus Biologicals
NBP2-48618 |
0.1 mL |
€ 572.00 € 540.75 / 0.10mL Save € 31.25 5% Off |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZBTB8A Polyclonal antibody specifically detects ZBTB8A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
| ZBTB8A | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Cancer, Cell Cycle and Replication | |
| PBS (pH 7.2), 40% Glycerol | |
| 653121 | |
| IgG | |
| Immunogen affinity purified |
| Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| BOZ-F1, BOZF1BTB/POZ and zinc-finger domains factor on chromosome 1, BTB/POZ and zinc-finger domain-containing factor, FLJ90065, MGC17919, ZBTB8, zinc finger and BTB domain containing 8, zinc finger and BTB domain containing 8A, zinc finger and BTB domain-containing protein 8A, ZNF916A | |
| This antibody was developed against a recombinant protein corresponding to amino acids: SQPSEVTHYKSSKREVRTSDSSSHVSQSEEQAQIDAEMDSTPVGYQYGQGSDVTSKSFPDDLPRMRFKCPYC | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title