missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZCCHC10 Antibody - Azide and BSA Free, Novus Biologicals™

ZCCHC10 Antibody - Azide and BSA Free, Novus Biologicals™

Product Code. p-200062801 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.02 mL
0.1 mL
Unit Size:
0.02mL
0.1mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
18649970 0.02 mL 0.02mL
18623881 0.1 mL 0.1mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Product Code. 18649970 Supplier Novus Biologicals Supplier No. NBP2946230.02ml

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

ZCCHC10 Polyclonal antibody specifically detects ZCCHC10 in Mouse samples. It is validated for Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZCCHC10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:500-1:2000
Formulation PBS (pH 7.3), 50% glycerol
Gene Alias FLJ20094, zinc finger CCHC domain-containing protein 10, zinc finger, CCHC domain containing 10
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human ZCCHC10 (NP_001287745.1). MATPMHRLIARRQAFDTELQPVKTFWILIQPSIVISEANKQHVRCQKCLEFGHWTYECTGKRKYLHRPSRTAELKKALKEKENRLLLQQSIGETNVERKA
Purification Method Affinity purified
Quantity 0.02 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 54819
Target Species Mouse
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.