missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZCCHC17 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68707
This item is not returnable.
View return policy
Description
ZCCHC17 Polyclonal antibody specifically detects ZCCHC17 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)
Specifications
| ZCCHC17 | |
| Polyclonal | |
| Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| HSPC251, nucleolar protein of 40 kDa, Pnn-interacting nucleolar protein, pNO40nucleolar protein 40, PS1D protein, PS1DRP11-266K22.1, putative S1 RNA binding domain protein, Putative S1 RNA-binding domain protein, Zinc finger CCHC domain-containing protein 17, zinc finger, CCHC domain containing 17 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK | |
| 100 μg | |
| metabolism | |
| 51538 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| Primary | |
| Human | |
| Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction