missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZDHHC20 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 227.00 - € 470.00
Specifications
| Antigen | ZDHHC20 |
|---|---|
| Dilution | Western Blot 1:500-1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18627310
|
Novus Biologicals
NBP2-94488-0.02ml |
0.02 mL |
€ 227.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18607791
|
Novus Biologicals
NBP2-94488-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZDHHC20 Polyclonal antibody specifically detects ZDHHC20 in Human, Mouse, Rat samples. It is validated for Western BlotSpecifications
| ZDHHC20 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cell Biology | |
| PBS (pH 7.3), 50% glycerol | |
| 253832 | |
| IgG | |
| Affinity purified |
| Western Blot 1:500-1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human, Mouse, Rat | |
| 4933421L13Rik, DHHC domain containing 20, EC 2.3.1, EC 2.3.1.-, MGC126005, zinc finger, DHHC-type containing 20 | |
| A synthetic peptide corresponding to a sequence within amino acids 270-365 of human ZDHHC20 (NP_001316988.1). VFGDEKKYWLLPIFSSLGDGCSFPTRLVGMDPEQASVTNQNEYARSSGSNQPFPIKPLSESKNRLLDSESQWLENGAEEGIVKSGTNNHVTVAIEN | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title