missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZFAND2A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 572.00
Specifications
| Antigen | ZFAND2A |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18457411
|
Novus Biologicals
NBP1-90864-25ul |
25 μL |
N/A
|
N/A | |||||
|
18220177
|
Novus Biologicals
NBP1-90864 |
0.1 mL |
€ 572.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZFAND2A Polyclonal specifically detects ZFAND2A in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZFAND2A | |
| Polyclonal | |
| Rabbit | |
| Human | |
| AN1-type zinc finger protein 2A, zinc finger, AN1-type domain 2A | |
| ZFAND2A | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| 90637 | |
| This antibody was developed against Recombinant Protein corresponding to amino acids:KGQIPDVVVGDHIDRDCDSHPGKKKEKIFTYRCSKEGCKKKEMLQMVCAQCHGNFCIQHRHPLDHSCRHGSRPTIKAG | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title