missing translation for 'onlineSavingsMsg'
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. 15868783

Invitrogen™ Zfp566 Polyclonal Antibody
GREENER_CHOICE

Product Code. 15868783
Change view
Click to view available options
Quantity:
100 μL
Unit Size:
100µL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
15868783 100 μL 100µL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 15868783 Supplier Invitrogen™ Supplier No. PA570376

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Description

Rabbit Polyclonal Antibody

This target displays homology in the following species: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%.

Zfp566 gene ontology annotations related to this gene include regulation of transcription, DNA-templated.
TRUSTED_SUSTAINABILITY

Specifications

Antigen Zfp566
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/mL
Conjugate Unconjugated
Formulation PBS with 2% sucrose and 0.09% sodium azide
Gene Zfp566
Gene Accession No. 0
Gene Alias 2700043M03Rik; mszf4; RGD1563239; Zfp566; zinc finger protein 566
Gene Symbols Zfp566
Host Species Rabbit
Immunogen synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI.
Purification Method Affinity chromatography
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 502316
Target Species Rat
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Product Type Antibody
Form Liquid
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.