missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZFYVE26 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-31606-25ul
This item is not returnable.
View return policy
Description
ZFYVE26 Polyclonal specifically detects ZFYVE26 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Specifications
| ZFYVE26 | |
| Polyclonal | |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Q68DK2 | |
| ZFYVE26 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: DSSKNESPPYSFVVRVPKADEVEWILDLKEEENELVRSEFYYEQAPSASLCIAILNLHRDSIACGHQLIEHCCRLSKGLTNPEVDAGLL | |
| 25 μL | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| DKFZp686F19106, DKFZp781H1112, FYVE domain-containing centrosomal protein, FYVE-CENT, KIAA0321zinc finger FYVE domain-containing protein 26, spastic paraplegia 15 (complicated, autosomal recessive), Spastizin, SPG15, zinc finger, FYVE domain containing 26 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 23503 | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction