missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZIC4 Antibody (3D5), Novus Biologicals™
Mouse Monoclonal Antibody
Brand: Novus Biologicals H00084107-M06
This item is not returnable.
View return policy
Description
ZIC4 Monoclonal antibody specifically detects ZIC4 in Human samples. It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| ZIC4 | |
| Monoclonal | |
| Unconjugated | |
| In 1x PBS, pH 7.4 | |
| FLJ42609, FLJ45833, Zic family member 4, Zinc finger protein of the cerebellum 4zinc family member 4 protein HZIC4, zinc finger protein ZIC 4 | |
| ZIC4 (NP_115529, 249 a.a. ∽ 319 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDRKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSALVSPSSDCGHKSQV | |
| 0.1 mg | |
| Primary | |
| Human | |
| Purified |
| Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry (Paraffin) | |
| 3D5 | |
| Western Blot 1:500, ELISA, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin | |
| NP_115529 | |
| Mouse | |
| IgG purified | |
| RUO | |
| 84107 | |
| Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles. | |
| IgG2a κ |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction