missing translation for 'onlineSavingsMsg'
Learn More
Learn More
Zinc finger protein 581 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-94501-0.02ml
This item is not returnable.
View return policy
Description
Zinc finger protein 581 Polyclonal antibody specifically detects Zinc finger protein 581 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)
Specifications
| Zinc finger protein 581 | |
| Polyclonal | |
| Western Blot 1:1000-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/ Immunofluorescence 1:50-1:200, Immunohistochemistry-Paraffin | |
| FLJ22550, HSPC189, zinc finger protein 581 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human ZNF581 (NP_057619.1). MLVLPSPCPQPLAFSSVETMEGPPRRTCRSPEPGPSSSIGSPQASSPPRPNHYLLIDTQGVPYTVLVDEESQREPGASGAPGQKKCYSCP | |
| 0.02 mL | |
| Primary | |
| Human, Mouse, Rat | |
| Purified |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.3), 50% glycerol | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 51545 | |
| Store at -20°C. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction