missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZKSCAN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-68756-25ul
This item is not returnable.
View return policy
Description
ZKSCAN3 Polyclonal antibody specifically detects ZKSCAN3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence
Specifications
| ZKSCAN3 | |
| Polyclonal | |
| Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
| dJ874C20.1, FLJ33906, ZF47, Zfp47, Zfp-47, Zinc finger and SCAN domain-containing protein 13, Zinc finger protein 306KIAA0426, Zinc finger protein 309ZNF306ZFP306, Zinc finger protein 47 homolog, zinc finger protein with KRAB and SCAN domains 3, zinc finger protein zfp47, zinc finger with KRAB and SCAN domains 3, ZNF309, ZSCAN13 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS | |
| 25 μL | |
| Primary | |
| Human | |
| Purified |
| Immunofluorescence | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol | |
| Rabbit | |
| Protein A purified | |
| RUO | |
| 80317 | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction