missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF148 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 470.00
Specifications
| Antigen | ZNF148 |
|---|---|
| Dilution | Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:20 - 1:100, Immunohistochemistry-Paraffin |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18653271
|
Novus Biologicals
NBP2-94521-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18681101
|
Novus Biologicals
NBP2-94521-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF148 Polyclonal antibody specifically detects ZNF148 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| ZNF148 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse, Rat | |
| BERF-1, BFCOL1, CACCC box-binding protein, CLL-associated antigen KW-10, HT-BETA, pHZ-52, Transcription factor ZBP-89, ZBP89, ZBP-89, ZFP148zinc finger protein 148 (pHZ-52), Zinc finger DNA-binding protein 89, zinc finger protein 148 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 690-794 of human ZNF148 (NP_068799.2). SGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500-1:1000, Immunohistochemistry 1:50-1:100, Immunocytochemistry/ Immunofluorescence 1:20 - 1:100, Immunohistochemistry-Paraffin | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 7707 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title