missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF167 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Brand: Novus Biologicals NBP2-13555-25ul
This item is not returnable.
View return policy
Description
ZNF167 Polyclonal specifically detects ZNF167 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Specifications
| ZNF167 | |
| Polyclonal | |
| Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:50-1:200 | |
| FLJ12738, ZFP, zinc finger protein 167, Zinc finger protein 448Zinc finger protein with KRAB and SCAN domains 7, Zinc finger protein 64ZNF448, ZKSCAN7ZNF64 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 55888 | |
| Human | |
| IgG |
| Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| ZNF167 | |
| This antibody was developed against a recombinant protein corresponding to the amino acids: PAQKQEMHFEETTALGTTKESPPTSPLSGGSAPGAHLEPPYDPGTHHLPSGDFAQCTSPVPTLPQVGNSGDQAG | |
| 25ul | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Ser du en mulighed for forbedring?Del en indholdskorrektion