missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZNF169 Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
€ 190.00 - € 470.00
Specifications
| Antigen | ZNF169 |
|---|---|
| Dilution | Western Blot 1:500 - 1:2000 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Product Code | Brand | Quantity | Price | Quantity & Availability | |||||
|
18637180
|
Novus Biologicals
NBP2-93181-0.02ml |
0.02 mL |
€ 190.00
0.02mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
|
18680151
|
Novus Biologicals
NBP2-93181-0.1ml |
0.1 mL |
€ 470.00
0.10mL |
Please sign in to purchase this item. Need a web account? Register with us today! | |||||
Description
ZNF169 Polyclonal antibody specifically detects ZNF169 in Human, Mouse samples. It is validated for Western BlotSpecifications
| ZNF169 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human, Mouse | |
| EC 2.1.1.43, MGC51961, zinc finger protein 169 | |
| Recombinant fusion protein containing a sequence corresponding to amino acids 1-85 of human ZNF169 (NP_919301.2). MSPGLLTTRKEALMAFRDVAVAFTQKEWKLLSSAQRTLYREVMLENYSHLVSLGIAFSKPKLIEQLEQGDEPWREENEHLLDLCP | |
| Primary | |
| Store at -20°C. Avoid freeze-thaw cycles. |
| Western Blot 1:500 - 1:2000 | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS (pH 7.3), 50% glycerol | |
| 169841 | |
| IgG | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title