missing translation for 'onlineSavingsMsg'
Learn More

ZNF331 Antibody [CoraFluorÖ 1], Novus Biologicals Biologicals™

Product Code. 30487987 Shop All Bio Techne Products
Change view
Click to view available options
Quantity:
0.1 mL
Unit Size:
0.10mL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Product Code. Quantity unitSize
30487987 0.1 mL 0.10mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Product Code. 30487987 Supplier Novus Biologicals Supplier No. NBP335559CL1

Please to purchase this item. Need a web account? Register with us today!

This item is not returnable. View return policy

Rabbit Polyclonal Antibody

ZNF331 Polyclonal antibody specifically detects ZNF331 in Human,Mouse,Rat samples. It is validated for ELISA,Western Blot
TRUSTED_SUSTAINABILITY

Specifications

Antigen ZNF331
Applications ELISA, Western Blot
Classification Polyclonal
Conjugate CoraFluor 1
Formulation PBS
Gene Alias ZFN533, zinc finger protein 385B, Zinc finger protein 533FLJ25270, ZNF533
Host Species Rabbit
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 50-130 of human ZNF331 (NP_061025.5).,, Sequence:, AYENKSLPTEKNIHEIRASKRNSDRRSKSLGRNWICEGTLERPQRSRGRYVNQMIINYVKRPATREGTPPRTHQRHHKENS
Purification Method Affinity purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55422
Target Species Human, Mouse, Rat
Content And Storage Store at 4°C in the dark. Do not freeze.
Product Type Antibody
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.